Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Anti-IRF2BP1 (aa109-122) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QDRYDRATSSGRLP, from the internal region of the protein sequence according to NP_056464.1. |
Rabbit Polyclonal Anti-IRF2BP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IRF2BP1 Antibody: synthetic peptide directed towards the middle region of human IRF2BP1. Synthetic peptide located within the following region: LVARNGEAEVSPTAGAEAVSGGGSGTGATPGAPLCCTLCRERLEDTHFVQ |
Rabbit Polyclonal Anti-Irf2bp1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Irf2bp1 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: ALTLAPGLSPARPLFGSDFEKEKQQRNADCLAELNEAMRGRAEEWHGRPK |
Carrier-free (BSA/glycerol-free) IRF2BP1 mouse monoclonal antibody,clone OTI3F4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IRF2BP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IRF2BP1 |
IRF2BP1 mouse monoclonal antibody,clone OTI3F4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
IRF2BP1 mouse monoclonal antibody,clone OTI3F4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
IRF2BP1 mouse monoclonal antibody,clone OTI3F4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
IRF2BP1 mouse monoclonal antibody,clone OTI3F4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- IRF2BP1