Antibodies

View as table Download

Rabbit Polyclonal Anti-IRF6 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IRF6

IRF6 (455-467) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from C-term of human IRF6

Goat Polyclonal Antibody against IRF6

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TPSMQLPPALPPQ, from the C Terminus of the protein sequence according to NP_006138.

Rabbit Polyclonal Anti-IRF6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the middle region of human IRF6. Synthetic peptide located within the following region: IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ

Rabbit Polyclonal Anti-IRF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the middle region of human IRF6. Synthetic peptide located within the following region: IPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQ

Rabbit Polyclonal Anti-IRF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF6 antibody: synthetic peptide directed towards the N terminal of human IRF6. Synthetic peptide located within the following region: ALHPRRVRLKPWLVAQVDSGLYPGLIWLHRDSKRFQIPWKHATRHSPQQE

Carrier-free (BSA/glycerol-free) IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IRF6 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IRF6 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IRF6 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IRF6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FKBP6 Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FKBP6

IRF6 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IRF6

IRF6 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 115-300 of human IRF6 (NP_006138.1).
Modifications Unmodified

IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP

IRF6 mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IRF6 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IRF6 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IRF6 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IRF6 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

IRF6 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

IRF6 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IRF6 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IRF6 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

IRF6 mouse monoclonal antibody, clone OTI1B9 (formerly 1B9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

IRF6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

IRF6 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IRF6 mouse monoclonal antibody,clone UMAB106

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) IRF6 mouse monoclonal antibody,clone UMAB106

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

IRF6 mouse monoclonal antibody,clone UMAB106

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".