Rabbit Polyclonal Anti-IRF8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRF8 antibody: synthetic peptide directed towards the N terminal of human IRF8. Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC |
Rabbit Polyclonal Anti-IRF8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRF8 antibody: synthetic peptide directed towards the N terminal of human IRF8. Synthetic peptide located within the following region: MFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRC |
Goat Polyclonal Antibody against ICSBP1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QRSFFRENQQITV, from the C Terminus of the protein sequence according to NP_002154. |
IRF8 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IRF8 rabbit polyclonal antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IRF8 |
IRF8 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IRF8 |
IRF8 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 137-426 of human IRF8 (NP_002154.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
