Rabbit Polyclonal Anti-IRF9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRF9 |
Rabbit Polyclonal Anti-IRF9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRF9 |
Rabbit Polyclonal anti-ISGF3G antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ISGF3G antibody: synthetic peptide directed towards the N terminal of human ISGF3G. Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK |
IRF9 rabbit polyclonal antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRF9 |
IRF9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 113-255 of human IRF9 (NP_006075.3). |
Modifications | Unmodified |