Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-IRX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRX2 Antibody: A synthesized peptide derived from human IRX2 |
IRX2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 187~216 amino acids from the Central region of Human IRX2 |
Rabbit Polyclonal Anti-IRX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IRX2 antibody is: synthetic peptide directed towards the middle region of Human IRX2. Synthetic peptide located within the following region: EDEDEDEGDATRSKDESPDKAQEGTETSAEDEGISLHVDSLTDHSCSAES |
Rabbit Polyclonal Anti-IRX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRX2 antibody: synthetic peptide directed towards the middle region of human IRX2. Synthetic peptide located within the following region: LEDDEDDDEEGERGLAPPKPVTSSPLTGLEAPLLSPPPEAAPRGGRKTPQ |
Rabbit Polyclonal Anti-Irx2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Irx2 antibody: synthetic peptide directed towards the c terminal of mouse Irx2. Synthetic peptide located within the following region: GETLHAMPKAASDTGKAGSHSLESHYRPPGGGYEPKKDTSEGCAVVGAGV |
Rabbit Polyclonal Anti-Irx2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Irx2 antibody: synthetic peptide directed towards the middle region of mouse Irx2. Synthetic peptide located within the following region: RRLKKENKMTWAPRNKSEDEDEDEGDASRSKEESSDKAQDGTETSAEDEG |
Rabbit Polyclonal Anti-IRX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRX2 antibody: synthetic peptide directed towards the N terminal of human IRX2. Synthetic peptide located within the following region: AYPYQLNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKM |
IRX2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IRX2 |
Active filters
Target Symbol
- IRX2