Antibodies

Jump to Filters
View as table Download
HBLD1 (ISCA2) (Center) Rabbit Polyclonal Antibody
AP52242PU-N

USD 450.00

2 Weeks

HBLD1 (ISCA2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 72-101 amino acids from the Central region of human ISCA2 / HBLD1
HBLD1 (ISCA2) Rabbit Polyclonal Antibody
TA337604

USD 375.00

5 Days

Rabbit Polyclonal Anti-ISCA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ISCA2 antibody: synthetic peptide directed towards the middle region of human ISCA2. Synthetic peptide located within the following region: RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY