Rabbit Polyclonal Anti-ISG15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Rabbit Polyclonal Antibody against ISG15 (Center R87)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ISG15 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the Central region of human ISG15. |
Anti-ISG15 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Carrier-free (BSA/glycerol-free) ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ISG15 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ISG15 |
ISG15 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ISG15 |
ISG15 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human ISG15 (NP_005092.1). |
| Modifications | Unmodified |
ISG15 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
