Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-ISL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ISL1 antibody is: synthetic peptide directed towards the C-terminal region of Human ISL1. Synthetic peptide located within the following region: IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPP |
Rabbit Polyclonal Anti-ISL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISL1 antibody: synthetic peptide directed towards the N terminal of human ISL1. Synthetic peptide located within the following region: IECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGAGDPLSPLH |
Carrier-free (BSA/glycerol-free) ISL1 mouse monoclonal antibody,clone OTI6E8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ISL1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse ISL1 |
Islet1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-349 of human Islet1 (NP_002193.2). |
| Modifications | Unmodified |
Islet 1 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Islet 1 |
Islet 1 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Islet1 |
Islet 1 Rabbit polyclonal Antibody
| Applications | FC, IF, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human Islet 1 |
ISL1 mouse monoclonal antibody,clone OTI6E8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ISL1 mouse monoclonal antibody,clone OTI6E8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ISL1 mouse monoclonal antibody,clone OTI6E8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ISL1 mouse monoclonal antibody,clone OTI6E8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ISL1 mouse monoclonal antibody, clone OTI2D8 (formerly 2D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ISL1