Antibodies

Jump to Filters
View as table Download
CDA08 (ITFG1) Rabbit Polyclonal Antibody
TA339563

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITFG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ITFG1 antibody: synthetic peptide directed towards the N terminal of human ITFG1. Synthetic peptide located within the following region: TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP
CDA08 (ITFG1) Rabbit Polyclonal Antibody
TA377594

USD 220.00

3 Weeks

ITFG1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 313-612 of human ITFG1 (NP_110417.2).
Modifications Unmodified