Antibodies

Jump to Filters
View as table Download
ITIH5 (C-term) Rabbit Polyclonal Antibody
AP52256PU-N

USD 450.00

2 Weeks

ITIH5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 578-606 amino acids from the C-terminal region of human ITIH5.
ITIH5 Rabbit Polyclonal Antibody
TA331262

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITIH5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ITIH5 antibody is: synthetic peptide directed towards the N-terminal region of Human ITIH5. Synthetic peptide located within the following region: ASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKR
ITIH5 Rabbit Polyclonal Antibody
TA331263

USD 375.00

5 Days

Rabbit Polyclonal Anti-ITIH5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ITIH5 antibody is: synthetic peptide directed towards the N-terminal region of Human ITIH5. Synthetic peptide located within the following region: AAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIF