Antibodies

View as table Download

ITIH5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 578-606 amino acids from the C-terminal region of human ITIH5.

Rabbit Polyclonal Anti-ITIH5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ITIH5 antibody is: synthetic peptide directed towards the N-terminal region of Human ITIH5. Synthetic peptide located within the following region: ASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKR

Rabbit Polyclonal Anti-ITIH5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ITIH5 antibody is: synthetic peptide directed towards the N-terminal region of Human ITIH5. Synthetic peptide located within the following region: AAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIF