Rabbit Polyclonal Anti-ITLN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITLN1 antibody: synthetic peptide directed towards the middle region of human ITLN1. Synthetic peptide located within the following region: WTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANA |
ITLN1 mouse monoclonal antibody, clone AT6C11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
ITLN1 mouse monoclonal antibody, clone AT6C11, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-ITLN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ITLN1 |
ITLN1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-313 of human ITLN1 (NP_060095.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China