Antibodies

Jump to Filters
View as table Download
IZUMO1 Rabbit Polyclonal Antibody
TA349034

USD 484.00

5 Days

Rabbit Polyclonal Anti-TOPAZ1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TOPAZ1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human TOPAZ1.
IZUMO1 Rabbit Polyclonal Antibody
TA339199

USD 375.00

5 Days

Rabbit Polyclonal Anti-IZUMO1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IZUMO1 antibody: synthetic peptide directed towards the C terminal of human IZUMO1. Synthetic peptide located within the following region: SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ
IZUMO1 Rabbit Polyclonal Antibody
TA377640

USD 220.00

3 Weeks

IZUMO1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human IZUMO1 (NP_872381.2).
Modifications Unmodified