Goat Polyclonal Anti-IDH3B (aa33-46) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3B (aa33-46) Antibody: Peptide with sequence C-HAASRSQAEDVRVE, from the internal region (near N Terminus) of the protein sequence according to NP_008830.2; NP_777280.1. |
Goat Anti-IDH3B (aa369-383) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | Peptide with sequence C-TTDFIKSVIGHLQTK, from the C Terminus of the protein sequence according to NP_008830.2; NP_777281.1. |
Rabbit Polyclonal Anti-IDH3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3B antibody is: synthetic peptide directed towards the N-terminal region of Human IDH3B. Synthetic peptide located within the following region: SEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRK |
Rabbit Polyclonal Anti-IDH3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3B antibody is: synthetic peptide directed towards the N-terminal region of Human IDH3B. Synthetic peptide located within the following region: RIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKF |
Rabbit Polyclonal Anti-IDH3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IDH3B antibody is: synthetic peptide directed towards the C-terminal region of Human IDH3B. Synthetic peptide located within the following region: YMTRHNNLDLVIIREQTEGEYSSLEHEVRPQKLGEGKDEDGREVELLVSL |
Rabbit Polyclonal Anti-IDH3B Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IDH3B |
IDH3B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human IDH3B |
IDH3B rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IDH3B |
IDH3B Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 35-170 of human IDH3B (NP_008830.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
