Rabbit Polyclonal Anti-Hdhd2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hdhd2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hdhd2. Synthetic peptide located within the following region: LMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIR |
Rabbit Polyclonal Anti-Ier3ip1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ier3ip1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRS |
Germany
Japan
United Kingdom
China