Antibodies

Jump to Filters
View as table Download
IFI44 Rabbit Polyclonal Antibody
TA339298

USD 375.00

5 Days

Rabbit Polyclonal Anti-IFI44 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFI44 antibody: synthetic peptide directed towards the middle region of human IFI44. Synthetic peptide located within the following region: LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS
Ifi44 Rabbit Polyclonal Antibody
TA377335

USD 220.00

3 Weeks

IFI44 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of mouse IFI44
Modifications Unmodified