Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against IFT74
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KTIVDALHSTSGN, from the C Terminus of the protein sequence according to NP_079379.1; AAK77221.1. |
Rabbit Polyclonal Anti-IFT74 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ift74 antibody is: synthetic peptide directed towards the middle region of RAT Ift74. Synthetic peptide located within the following region: NMSPEKQVKYIEMKTTNEKLLQELDTLQQQLDSLNIKKESLETEIAHSQV |
Goat Anti-CMG1 / CCDC2 / IFT74, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KTIVDALHSTSGN., from the C Terminus of the protein sequence according to NP_001092692.1; NP_001092693.1; NP_079379.2; AAK77221.1. |
Rabbit Polyclonal Anti-IFT74 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IFT74 |
IFT74 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IFT74 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-372 of human IFT74 (NP_001092694.1). |
| Modifications | Unmodified |
IFT74 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-372 of human IFT74 (NP_001092694.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IFT74