Goat Polyclonal Antibody against IGFBP4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KGELDCHQLADSFRE, from the C Terminus of the protein sequence according to NP_001543.2. |
Goat Polyclonal Antibody against IGFBP4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KGELDCHQLADSFRE, from the C Terminus of the protein sequence according to NP_001543.2. |
IGFBP4 mouse monoclonal antibody, clone IBP144
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IGFBP4 mouse monoclonal antibody, clone IBP182
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IGFBP4 mouse monoclonal antibody, clone IBP190
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IGFBP4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IGFBP4 antibody: synthetic peptide directed towards the middle region of human IGFBP4. Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV |
IGFBP4 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of Human IGFBP4. |
Anti-IGFBP4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 22-258 amino acids of human insulin-like growth factor binding protein 4 |
IGFBP4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 178-258 of human IGFBP4 (NP_001543.2). |
Modifications | Unmodified |
IGFBP4 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-258 of human IGFBP4 (NP_001543.2). |
Modifications | Unmodified |