Antibodies

Jump to Filters
View as table Download
RED (IK) Rabbit Polyclonal Antibody
TA308401

USD 415.00

In Stock

Rabbit polyclonal antibody to RED (RED cytokine, down-regulator of HLA II)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of RED (Uniprot ID#Q13123)
Ik Rabbit Polyclonal Antibody
TA339183

USD 375.00

5 Days

Rabbit Polyclonal Anti-Ik

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ik antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ik. Synthetic peptide located within the following region: GIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKRMEADGVEVKRPK
RED (IK) Rabbit Polyclonal Antibody
TA314064

USD 345.00

4 Weeks

Rabbit polyclonal anti-RED antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RED.
RED (IK) Rabbit Polyclonal Antibody
TA377402

USD 220.00

3 Weeks

IK Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human IK (NP_006074.2).
Modifications Unmodified