Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against IKZF1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLLRAASENSQDALR, from the internal region of the protein sequence according to NP_006051.1. |
Mouse Monoclonal Ikaros (C-terminus) Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ZNFN1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNFN1A1 antibody: synthetic peptide directed towards the middle region of human ZNFN1A1. Synthetic peptide located within the following region: LHKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTD |
Rabbit Polyclonal anti-IKZF1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IKZF1 antibody: synthetic peptide directed towards the middle region of human IKZF1. Synthetic peptide located within the following region: DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK |
Rabbit Polyclonal Anti-IKZF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IKZF1 antibody: synthetic peptide directed towards the middle region of human IKZF1. Synthetic peptide located within the following region: QDSTDTESNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASEN |
Ikzf1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Ikzf1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Ikaros Rabbit polyclonal Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Ikaros |
Active filters
Target Symbol
- IKZF1