Germany
Japan
United Kingdom
China
Antibodies
View as table Download
IL15 mouse monoclonal antibody, clone B-E29, Azide Free
| Applications | FN |
| Reactivities | Human |
Rabbit polyclonal anti-IL-15 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed mouse IL-15 |
Biotinylated Anti-Murine IL-15 Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine IL-15 |
Anti-Murine IL-15 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine IL-15 |
Rabbit polyclonal Anti-IL15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL15 antibody: synthetic peptide directed towards the N terminal of human IL15. Synthetic peptide located within the following region: RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV |
Carrier-free (BSA/glycerol-free) IL15 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL15 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL15 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
IL15 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL15. |
| Modifications | Unmodified |
IL15 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
IL15 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL15 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
IL15 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
IL15 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
IL15 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
IL15 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
IL15 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- IL15