Germany
Japan
United Kingdom
China
Rabbit anti-IL27 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL27 |
Antibodies
View as table Download
IL27 mouse monoclonal antibody, clone B-G49, Azide Free
| Applications | FC |
| Reactivities | Human |
IL27 mouse monoclonal antibody, clone B-G49, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
IL27 mouse monoclonal antibody, clone B-G49, Purified
| Applications | FC |
| Reactivities | Human |
IL27 mouse monoclonal antibody, clone B-G44, Azide Free
| Applications | ELISA |
| Reactivities | Human |
Rabbit Polyclonal IL-27 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IL-27 antibody was raised against a 14 amino acid peptide from near the center of human IL-27. |
Rabbit polyclonal IL-27/p28 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant mouse IL27/p28 protein. |
Rabbit polyclonal IL-27/p28 antibody Peroxidase Conjugated
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant mouse IL27/p28 protein. |
Rabbit Polyclonal Anti-IL27 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL27 antibody: synthetic peptide directed towards the C terminal of human IL27. Synthetic peptide located within the following region: AQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQ |
Anti-IL27 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Active filters
Target Symbol
- IL27