Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Interleukin 5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5 |
Il5 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure recombinant Murine IL-5 |
Il5 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure recombinant Murine IL-5 |
Il5 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Immunogen | Highly pure recombinant Murine IL-5 |
Il5 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Immunogen | Highly pure recombinant Murine IL-5 |
Rabbit Polyclonal Anti-Il5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Il5 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGL |
Rabbit Polyclonal Anti-IL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Rhesus Macaque, Cynomolgus Monkey, Human |
| Conjugation | Unconjugated |
IL5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-134 of human IL5 (NP_000870.1). |
| Modifications | Unmodified |
Recombinant Anti-IL-5 (Clone 2E3)
| Applications | ELISA, Neutralize |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-IL-5 (Clone 2E3)
| Applications | ELISA, Neutralize |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- IL5