Germany
Japan
United Kingdom
China
IL9 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%), E.coli derived 14.0 kDa recombinant Human IL-9 |
Antibodies
View as table Download
Il9 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Mouse |
| Immunogen | Highly pure (>98%) recombinant mIL-9 |
Il9 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Mouse |
| Immunogen | Highly pure (>98%) recombinant mIL-9 |
IL9 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%), E.coli derived 14.0 kDa recombinant Human IL-9 |
Il9 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant mIL-9. |
Il9 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant mIL-9. |
IL9 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hIL-9 (human IL-9). |
IL9 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hIL-9 (human IL-9). |
Rabbit polyclonal anti-IL-9 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein. |
Rabbit polyclonal IL-9 antibody Peroxidase Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-9 protein. |
Biotinylated Anti-Murine IL-9 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine IL-9 |
Anti-Murine IL-9 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine IL-9 |
Rabbit Polyclonal Anti-IL9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL9 Antibody: synthetic peptide directed towards the middle region of human IL9. Synthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT |
IL9 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL9 |
Recombinant Anti-IL-9 (Clone D9302C12)
| Applications | Bl, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Recombinant Anti-IL-9 (Clone D9302C12)
| Applications | Bl, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG2 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-IL-9 (Clone MH9A4)
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-IL-9 (Clone MH9A4)
| Applications | ELISA, FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-IL-9 (Clone RM9A4)
| Applications | ELISA, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-IL-9 (Clone RM9A4)
| Applications | ELISA, FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- IL9
Filter by
Category
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)