Antibodies

View as table Download

Rabbit Polyclonal Anti-IMP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IMP3 antibody: synthetic peptide directed towards the middle region of human IMP3. Synthetic peptide located within the following region: GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE

IMP3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 155~184 amino acids from the C-terminal region of human IMP3

Goat Anti-IMP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRREDYTRYNQLSR, from the internal region of the protein sequence according to NP_060755.1.

IMP3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human IMP3

IMP3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-184 of human IMP3 (NP_060755.1).
Modifications Unmodified