Antibodies

Jump to Filters
View as table Download
INO80C Rabbit Polyclonal Antibody
TA337356

USD 375.00

5 Days

Rabbit Polyclonal Anti-INO80C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-INO80C antibody is: synthetic peptide directed towards the N-terminal region of Human INO80C. Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME