Rabbit Polyclonal antibody to INPP5F (inositol polyphosphate-5-phosphatase F)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 593 and 904 of INPP5F |
Rabbit Polyclonal Anti-INPP5F Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-INPP5F Antibody is: synthetic peptide directed towards the N-terminal region of Human INPP5F. Synthetic peptide located within the following region: VCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKIIPSPDDSKFLLK |
INPP5F Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human INPP5F |
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
