Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-ISGF3G antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ISGF3G antibody: synthetic peptide directed towards the N terminal of human ISGF3G. Synthetic peptide located within the following region: PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNK |
IRF9 rabbit polyclonal antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IRF9 |
IRF9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 113-255 of human IRF9 (NP_006075.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IRF9