Antibodies

Jump to Filters
View as table Download
Josephin 1 (JOSD1) Rabbit Polyclonal Antibody
TA337367

USD 375.00

5 Days

Rabbit Polyclonal Anti-JOSD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JOSD1 antibody is: synthetic peptide directed towards the N-terminal region of Human JOSD1. Synthetic peptide located within the following region: DKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAFTRDTLQE
Josephin 1 (JOSD1) Rabbit Polyclonal Antibody
TA337366

USD 375.00

5 Days

Rabbit Polyclonal Anti-JOSD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-JOSD1 antibody is: synthetic peptide directed towards the N-terminal region of Human JOSD1. Synthetic peptide located within the following region: SCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCALHALNNVFQDSNAF
Josephin 1 (JOSD1) Mouse Monoclonal Antibody [Clone ID: OTI3B11]
CF502210

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) JOSD1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
JOSD1 Rabbit Polyclonal Antibody
TA366412

USD 380.00

4 Weeks

JOSD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human JOSD1
JOSD1 Rabbit Polyclonal Antibody
TA370761

USD 380.00

4 Weeks

JOSD1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human JOSD1
Josephin 1 (JOSD1) Rabbit Polyclonal Antibody
TA377662

USD 220.00

3 Weeks

JOSD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-202 of human JOSD1 (NP_055691.1).
Modifications Unmodified