Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-JPH2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JPH2 antibody: synthetic peptide directed towards the middle region of human JPH2. Synthetic peptide located within the following region: ANQESNIARTLARELAPDFYQPGPEYQKRRLLQEILENSESLLEPPDRGA |
Carrier-free (BSA/glycerol-free) JPH2 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JPH2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Jph2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
JPH2 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human JPH2 |
JPH2 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
JPH2 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
JPH2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
JPH2 mouse monoclonal antibody, clone OTI2E5 (formerly 2E5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- JPH2