Antibodies

Jump to Filters
View as table Download
JPH3 (C-term) Rabbit Polyclonal Antibody
AP23014PU-N

USD 525.00

2 Weeks

JPH3 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide of 18 amino acid peptide near the carboxy terminus of human JPH3
JPH3 Rabbit Polyclonal Antibody
AP23015PU-N

USD 525.00

2 Weeks

JPH3 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen 18 amino acid peptide near the center of human JPH3
JPH3 Rabbit Polyclonal Antibody
TA306683

USD 430.00

5 Days

Rabbit Polyclonal JPH3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen JPH3 antibody was raised against a 18 amino acid peptide near the carboxy terminus of human JPH3.
JPH3 Rabbit Polyclonal Antibody
TA306686

USD 430.00

5 Days

Rabbit Polyclonal JPH3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen JPH3 antibody was raised against a 18 amino acid peptide near the center of human JPH3.
JPH3 Rabbit Polyclonal Antibody
TA338428

USD 375.00

5 Days

Rabbit Polyclonal Anti-JPH3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JPH3 antibody: synthetic peptide directed towards the N terminal of human JPH3. Synthetic peptide located within the following region: SSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLG