Antibodies

View as table Download

KCNA3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA3

Rabbit Polyclonal Anti-KV1.3 (extracellular)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human Kv1.3.Extracellular loop between domains S1 and S2.

KCNA3 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Mouse monoclonal Kv1.3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

KCNA3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 238-268 amino acids from the Central region of human KCNA3

Rabbit Polyclonal Anti-KV1.3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3. Intracellular, C-terminus.

Rabbit Polyclonal Anti-KCNA3 Antibody (Internal)

Applications IHC
Reactivities Human
Immunogen KCNA3 / Kv1.3 antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNA3 / Kv1.3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Mouse, Rat (88%).

Rabbit Polyclonal Anti-KCNA3 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen KCNA3 / Kv1.3 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human KCNA3 / Kv1.3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Rabbit, Pig (100%); Bovine, Opossum (94%); Lizard (88%); Turkey, Chicken (81%).

KCNA3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNA3