Antibodies

View as table Download

KCNB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNB1

KCNB1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNB1

Rabbit polyclonal Kv2.1 (Ser805) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Kv2.1 around the phosphorylation site of serine 805 (P-T-SP-P-K).
Modifications Phospho-specific

Rabbit Polyclonal Kv2.1 (Ser805) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Kv2.1 around the phosphorylation site of Serine 805
Modifications Phospho-specific

Mouse Monoclonal Anti-Kv2.1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Anti-KV2.1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (CY)HMLPGGGAHGSTRDQSI, corresponding to amino acid residues 841-857 of rat Kv2.1 . Intracellular, C-terminus.

Mouse Monoclonal Anti-Kv2.1 Antibody

Applications IHC
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal Anti-Kv2.1 (Extracellular) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-KCNB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNB1 antibody: synthetic peptide directed towards the middle region of human KCNB1. Synthetic peptide located within the following region: YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT

Rabbit Polyclonal Anti-KCNB1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNB1

KCNB1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human KCNB1

KCNB1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNB1