Antibodies

View as table Download

Mouse Monoclonal anti-KCNC1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Kcnc1 mouse monoclonal antibody, clone N16B/8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Kcnc1 mouse monoclonal antibody, clone N16B/8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Anti-KV3.1b

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide CKESPVIAKYMPTEAVRVT, corresponding to amino acid residues 567-585 of rat Kv3.1b .? ? Intracellular, C-terminus.

Rabbit Polyclonal Potassium Channel Kv3.1 Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of rat Kv3.1 (within residues 350-400). [Swiss-Prot# P25122]

Rabbit Polyclonal Anti-KCNC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNC1 antibody: synthetic peptide directed towards the N terminal of human KCNC1. Synthetic peptide located within the following region: TYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNY

Anti-KCNC1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1

Anti-KCNC1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1

KCNC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human KCNC1
Modifications Unmodified