Antibodies

Jump to Filters
View as table Download
Kcnj1 Rabbit Polyclonal Antibody
TA328922

USD 585.00

3 Weeks

Rabbit polyclonal Anti-Kir1.1

Applications IHC, WB
Reactivities Mouse, Rat
Immunogen GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK1, (MW: 33 kDa). Intracellular, C-terminus.
KCNJ1 Goat Polyclonal Antibody
TA305615

USD 375.00

5 Days

Goat Anti-KCNJ1 / ROMK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DQININFVVDAGNEN , from the internal region of the protein sequence according to NP_000211.1; NP_722448.1.
KCNJ1 Rabbit Polyclonal Antibody
TA338741

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNJ1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ1 antibody: synthetic peptide directed towards the middle region of human KCNJ1. Synthetic peptide located within the following region: LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP
Kcnj1 Rabbit Polyclonal Antibody
TA363179

USD 360.00

5 Days

KCNJ1 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse KCNJ1
KCNJ1 Rabbit Polyclonal Antibody
TA377714

USD 220.00

3 Weeks

KCNJ1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 182-391 of human KCNJ1 (NP_000211.1).
Modifications Unmodified