Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-KCNJ4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KCNJ4. |
Antibodies
View as table Download
Mouse monoclonal Kir2.3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
KIR2.3 (KCNJ4) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human KCNJ4 |
Rabbit polyclonal Anti-Kir2.3
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)EFGS HLDLE RMQAA TLPLD N, corresponding to amino acid residues 418-437 of rat Kir2.3.Intracellular, C-terminal part. |
Rabbit Polyclonal Anti-KCNJ4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNJ4 antibody: synthetic peptide directed towards the middle region of human KCNJ4. Synthetic peptide located within the following region: AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI |
KCNJ4 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ4 (NP_004972.1). |
| Modifications | Unmodified |
KCNJ4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 316-445 of human KCNJ4 (NP_690607.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KCNJ4