Rabbit Polyclonal Anti-K2P3.1 (TASK-1)
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)EDEKRDAEHRALLTRNGQ, corresponding to amino acid residues 252-269 of human K2P3.1 (TASK-1). Intracellular, C-terminal part. |
Rabbit Polyclonal Anti-K2P3.1 (TASK-1)
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)EDEKRDAEHRALLTRNGQ, corresponding to amino acid residues 252-269 of human K2P3.1 (TASK-1). Intracellular, C-terminal part. |
Rabbit Polyclonal Anti-KCNK3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNK3 antibody: synthetic peptide directed towards the C terminal of human KCNK3. Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL |
Rabbit Polyclonal Anti-KCNK3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNK3 |