Germany
Japan
United Kingdom
China
KCNQ3 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNQ3 |
Antibodies
View as table Download
KCNQ3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 650-679 amino acids from the C-terminal region of human KCNQ3 |
Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human: Thr246, Mouse: Thr247, Rat: Thr247 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal Anti-KV7.3 (KCNQ3)
| Applications | WB |
| Reactivities | Mouse, Rat |
| Immunogen | Peptide AEGEKKEDNRYSDLKTIIC, corresponding to amino acid residues 668-686 of rat Kv7.3 . Intracellular, C-terminal. |
Rabbit Polyclonal Anti-Kcnq3 Antibody
| Applications | WB |
| Reactivities | Hamster, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ |
Active filters
Target Symbol
- KCNQ3