Goat Anti-KCTD11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PEVEYGRLGLQP, from the internal region of the protein sequence according to NP_001002914.1. |
Goat Anti-KCTD11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PEVEYGRLGLQP, from the internal region of the protein sequence according to NP_001002914.1. |
Rabbit Polyclonal Anti-KCTD11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCTD11 antibody: synthetic peptide directed towards the N terminal of human KCTD11. Synthetic peptide located within the following region: RLGRLDLPRGYGETALLRAEADFYQIRPLLDALRELEASQGTPAPTAALL |
Rabbit Polyclonal Anti-KCTD11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCTD11 antibody: synthetic peptide directed towards the N terminal of human KCTD11. Synthetic peptide located within the following region: ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH |