Antibodies

Jump to Filters
View as table Download
KDELR2 Rabbit Polyclonal Antibody
AP21062PU-N

USD 370.00

2 Weeks

KDELR2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
KDELR2 (C-term) Rabbit Polyclonal Antibody
AP52327PU-N

USD 450.00

2 Weeks

KDELR2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 182-211 amino acids from the C-terminal region of human KDELR2
KDELR2 Rabbit Polyclonal Antibody
TA332202

USD 375.00

5 Days

Rabbit Polyclonal Anti-KDELR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KDELR2 Antibody is: synthetic peptide directed towards the C-terminal region of Human KDELR2. Synthetic peptide located within the following region: ASVLQGARTEFLPQQRHKMLDTENQKLNSFVADSHQWLCKNAEEKSQKVS
KDELR2 Rabbit Polyclonal Antibody
TA332203

USD 375.00

5 Days

Rabbit Polyclonal Anti-KDELR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KDELR2 Antibody is: synthetic peptide directed towards the middle region of Human KDELR2. Synthetic peptide located within the following region: PVGGLSFLVNHDFSPLEYSRERSSVCQHKCQRPSPASVLQGARTEFLPQQ