Rabbit Polyclonal Anti-C1orf172 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C1orf172 Antibody is: synthetic peptide directed towards the C-terminal region of Human C1orf172. Synthetic peptide located within the following region: LSQDELTVQISQETTADAIARKLRPYGAPGYPASHDSSFQGTDTDSSGAP |
Rabbit Polyclonal Anti-1810019J16Rik Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-1810019J16Rik Antibody is: synthetic peptide directed towards the middle region of Mouse 1810019J16Rik. Synthetic peptide located within the following region: IIRISTRKSRSRPQTSEGRSARSTAPAAAPDSGHETMLGSGLSQDELTVQ |
KDF1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KDF1 |
Germany
Japan
United Kingdom
China