Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 21 of 21 results

(reset)

KDM4C Rabbit Polyclonal Antibody

TA309711

USD 457.00

5 Days

Rabbit Polyclonal JMJD2C Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A genomic peptide made to an internal region of the human JMJD2C protein (within residues 450-600). [Swiss-Prot Q9H3R0]

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

KDM4C (C-term) Rabbit Polyclonal Antibody

AP52272PU-N

USD 450.00

2 Weeks

KDM4C (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 1030-1056 amino acids from the C-terminal region of human JMJD2C

1 / 2

2 / 2

Previous Next

KDM4C Rabbit Polyclonal Antibody

TA347228

USD 315.00

5 Days

Rabbit Polyclonal JMJD2c Antibody

Applications	ELISA, WB
Reactivities	Human
Immunogen	The immunogen for anti-JMJD2c antibody: human JMJD2c (Jumonji Domain containing 2c), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the central part of the protein.

1 / 2

2 / 2

Previous Next

KDM4C Rabbit Polyclonal Antibody

TA332172

USD 375.00

5 Days

Rabbit Polyclonal Anti-JMJD2C Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-JMJD2C Antibody: synthetic peptide directed towards the middle region of human JMJD2C. Synthetic peptide located within the following region: CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERTQIDVGRIPLQR

KDM4C Mouse Monoclonal Antibody [Clone ID: OTI5B9]

CF500567

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications	IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

KDM4C Mouse Monoclonal Antibody [Clone ID: OTI4B1]

CF500587

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) KDM4C mouse monoclonal antibody, clone OTI4B1 (formerly 4B1)

Applications	FC, IF, IHC
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

KDM4C Mouse Monoclonal Antibody [Clone ID: OTI8A1]

CF500588

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

KDM4C Rabbit Polyclonal Antibody

TA351311

USD 345.00

In Stock

Rabbit Polyclonal Anti-KDM4C Antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human KDM4C

KDM4C Rabbit Polyclonal Antibody

TA377757

USD 220.00

3 Weeks

KDM4C Rabbit polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 350-570 of human KDM4C (NP_055876.2).
Modifications	Unmodified

KDM4C Mouse Monoclonal Antibody [Clone ID: OTI5B9]

TA500567

USD 379.00

In Stock

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications	IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

KDM4C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B9]

TA500567AM

USD 420.00

4 Weeks

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

KDM4C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B9]

TA500567BM

USD 420.00

4 Weeks

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

KDM4C Mouse Monoclonal Antibody [Clone ID: OTI5B9]

TA500567S

USD 159.00

2 Days

Anti-KDM4C mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)

Applications	IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

KDM4C Mouse Monoclonal Antibody [Clone ID: OTI4B1]

TA500587

USD 379.00

In Stock

KDM4C mouse monoclonal antibody, clone OTI4B1 (formerly 4B1)

Applications	FC, IF, IHC
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

KDM4C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B1]

TA500587AM

USD 420.00

4 Weeks

KDM4C mouse monoclonal antibody, clone OTI4B1 (formerly 4B1), Biotinylated

Applications	FC, IF, IHC
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

KDM4C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B1]

TA500587BM

USD 420.00

4 Weeks

KDM4C mouse monoclonal antibody, clone OTI4B1 (formerly 4B1), HRP conjugated

Applications	FC, IF, IHC
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

KDM4C Mouse Monoclonal Antibody [Clone ID: OTI4B1]

TA500587S

USD 159.00

In Stock

KDM4C mouse monoclonal antibody, clone OTI4B1 (formerly 4B1)

Applications	FC, IF, IHC
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

KDM4C Mouse Monoclonal Antibody [Clone ID: OTI8A1]

TA500588

USD 379.00

In Stock

Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

KDM4C Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8A1]

TA500588AM

USD 420.00

4 Weeks

Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1), Biotinylated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

KDM4C Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8A1]

TA500588BM

USD 420.00

4 Weeks

Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1), HRP conjugated

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

KDM4C Mouse Monoclonal Antibody [Clone ID: OTI8A1]

TA500588S

USD 159.00

2 Days

Anti-KDM4C mouse monoclonal antibody, clone OTI8A1 (formerly 8A1)

Applications	IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

1 - 21 of 21 results