Germany
Japan
United Kingdom
China
Anti-KEAP1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human kelch-like ECH-associated protein 1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-KEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1. Synthetic peptide located within the following region: HTFLDSVECYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC |
Rabbit Polyclonal KEAP1 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-Keap1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keap1 Antibody: A synthesized peptide derived from human Keap1 |
Rabbit Polyclonal Anti-KEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the N terminal of human KEAP1. Synthetic peptide located within the following region: SQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHTKQAFGIMNEL |
Rabbit Polyclonal Anti-KEAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KEAP1 antibody: synthetic peptide directed towards the C terminal of human KEAP1. Synthetic peptide located within the following region: TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS |
Carrier-free (BSA/glycerol-free) KEAP1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KEAP1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KEAP1 |
KEAP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KEAP1 |
KEAP1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KEAP1 |
KEAP1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KEAP1 (NP_036421.2). |
| Modifications | Unmodified |
KEAP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 325-624 of human KEAP1 (NP_036421.2). |
| Modifications | Unmodified |
KEAP1 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human KEAP1. |
KEAP1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human KEAP1. |
Keap1 Rabbit monoclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
KEAP1 mouse monoclonal antibody, clone OTI1G2 (formerly 1G2)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
KEAP1 mouse monoclonal antibody, clone OTI1A1 (formerly 1A1)
| Applications | FC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
KEAP1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 462.00
2 Weeks
KEAP1 mouse monoclonal antibody,clone 1B4, Biotinylated
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
KEAP1 mouse monoclonal antibody,clone 1B4, HRP conjugated
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
KEAP1 mouse monoclonal antibody, clone OTI1B4 (formerly 1B4)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- KEAP1