Rabbit Polyclonal Anti-KIF22 Antibody
| Applications | WB |
| Reactivities | Human, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF22 antibody: synthetic peptide directed towards the N terminal of human KIF22. Synthetic peptide located within the following region: CSLEIANWRNHQETLKYQFDAFYGERSTQQDIYAGSVQPILRHLLEGQNA |
Rabbit Polyclonal Anti-KIF22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF22 antibody: synthetic peptide directed towards the C terminal of human KIF22. Synthetic peptide located within the following region: LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ |
KIF22 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human KIF22 |
KIF22 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 456-665 of human KIF22 (NP_015556.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
