Rabbit Polyclonal Anti-KIF3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KIF3A |
Rabbit Polyclonal Anti-KIF3A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KIF3A |
Rabbit Polyclonal Anti-KIF3A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KIF3A antibody: synthetic peptide directed towards the C terminal of human KIF3A. Synthetic peptide located within the following region: PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR |
KIF3A rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KIF3A |
KIF3A Rabbit polyclonal Antibody
Applications | IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 430-699 of human KIF3A (NP_008985.3). |
Modifications | Unmodified |