Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Antibodies
View as table Download
Anti-KIR2DL3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 22-245 amino acids of human killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 3 |
Rabbit Polyclonal Anti-KIR2DL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIR2DL3 antibody is: synthetic peptide directed towards the middle region of Human KIR2DL3. Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP |
KIR2DL2/3 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human KIR2DL3/KIR2DS2. AA range:131-180 |
Active filters
Target Symbol
- KIR2DL3