Antibodies

Jump to Filters
View as table Download
KIR2DL5B Rabbit Polyclonal Antibody
TA338338

USD 375.00

5 Days

Rabbit Polyclonal Anti-KIR2DL5B Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-KIR2DL5B antibody is: synthetic peptide directed towards the C-terminal region of Human KIR2DL5B. Synthetic peptide located within the following region: DQDPQEVTYAQLDHCVFTQTKITSPSQRPKAPPTDTTMYMELPNAKPRSL
KIR2DL5B Rabbit Polyclonal Antibody
TA313919

USD 345.00

4 Weeks

Rabbit polyclonal anti-Killer cell immunoglobulin-like receptor 2DL5B (KIR2DL5B) antibody

Applications IF
Reactivities Human
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KIR2DL5B.