Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KIR3DL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KIR3DL1 antibody is: synthetic peptide directed towards the middle region of Human KIR3DL1. Synthetic peptide located within the following region: EHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVT |
KIR3DL1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KIR3DL1 |
KIR3DL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-222 of human KIR3DL1 (NP_037421.2). |
| Modifications | Unmodified |
KIR3DL1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) within Human KIR3DL1 ( NP_037421). The exact sequence is proprietary. |
KIR3DL1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) within Human KIR3DL1 ( NP_037421). The exact sequence is proprietary. |
Active filters
Target Symbol
- KIR3DL1