Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SCF (KITLG) mouse monoclonal antibody, clone hKL12, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Primate |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hSCF (anti-hSCF). |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hSCF. |
Rabbit Polyclonal Anti-SCF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCF Antibody: Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF. |
SCF (KITLG) mouse monoclonal antibody, Azide Free
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Kitlg rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, NEUT, WB |
| Reactivities | Rat |
| Immunogen | Highly pure (>98%) recombinant Rat SCF. |
Kitlg rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, NEUT, WB |
| Reactivities | Rat |
| Immunogen | Highly pure (>98%) recombinant Rat SCF. |
Rabbit Polyclonal Antibody against KITLG (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCF (KITLG) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human SCF (KITLG). |
SCF (KITLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hSCF. |
SCF (KITLG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hSCF. |
Kitlg rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Rat |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant Rat SCF. |
Kitlg rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Rat |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant Rat SCF. |
Anti-KITLG Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.265~269(E-K-E-R-E) derived from Human SCF. |
Rabbit Polyclonal Anti-KITLG Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KITLG antibody: synthetic peptide directed towards the middle region of human KITLG. Synthetic peptide located within the following region: TKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIG |
Carrier-free (BSA/glycerol-free) KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KITLG Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-214 of human KITLG (NP_000890.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
KITLG mouse monoclonal antibody, clone OTI5E9 (formerly 5E9)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- KITLG