Antibodies

View as table Download

KLF1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KLF1

Goat Anti-KLF1 / EKLF Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence ATAETALPSISTLT-C, from the N Terminus of the protein sequence according to NP_006554.1.

KLF1 (+GKLF) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-KLF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF1 antibody: synthetic peptide directed towards the middle region of human KLF1. Synthetic peptide located within the following region: PKALALQPVYPGPGAGSSGGYFPRTGLSVPAASGAPYGLLSGYPAMYPAP

Rabbit Polyclonal Anti-KLF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF1 antibody: synthetic peptide directed towards the N terminal of human KLF1. Synthetic peptide located within the following region: MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPP

Rabbit Polyclonal Anti-KLF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF1 antibody: synthetic peptide directed towards the middle region of human KLF1. Synthetic peptide located within the following region: SVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS

KLF1 Antibody - C-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse KLF1

KLF1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human KLF1

KLF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KLF1 (NP_006554.1).
Modifications Unmodified