Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-KLF11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KLF11 |
Antibodies
View as table Download
Rabbit polyclonal TIEG2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TIEG2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-36 amino acids from the N-terminal region of human TIEG2. |
Rabbit Polyclonal Anti-KLF11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF11 Antibody: A synthesized peptide derived from human KLF11 |
Rabbit polyclonal anti-KLF11 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human KLF11. |
Rabbit polyclonal anti-Klf11 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Klf11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDH |
Rabbit Polyclonal anti-KLF11 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF11 antibody: synthetic peptide directed towards the N terminal of human KLF11. Synthetic peptide located within the following region: SQKGDLLRIRPLTPVSDSGDVTTTVHMDAATPELPKDFHSLSTLCITPPQ |
Rabbit Polyclonal Anti-Klf11 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Klf11 antibody is: synthetic peptide directed towards the N-terminal region of Rat Klf11. Synthetic peptide located within the following region: AADIMDICESILERKRHDSERSTCSILEQTDIEAVEALVCMSSWGQRSQV |
Rabbit Polyclonal Anti-KLF11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF11 antibody: synthetic peptide directed towards the C terminal of human KLF11. Synthetic peptide located within the following region: KFARSDELSRHRRTHTGEKKFVCPVCDRRFMRSDHLTKHARRHMTTKKIP |
Carrier-free (BSA/glycerol-free) KLF11 mouse monoclonal antibody,clone OTI2A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KLF11 mouse monoclonal antibody,clone OTI3G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KLF11 rabbit polyclonal antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KLF11 |
KLF11 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KLF11. |
KLF11 mouse monoclonal antibody,clone OTI2A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
KLF11 mouse monoclonal antibody,clone OTI2A4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
KLF11 mouse monoclonal antibody,clone OTI2A4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
KLF11 mouse monoclonal antibody,clone OTI2A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KLF11 mouse monoclonal antibody,clone OTI3G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
KLF11 mouse monoclonal antibody,clone OTI3G4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
KLF11 mouse monoclonal antibody,clone OTI3G4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
KLF11 mouse monoclonal antibody,clone OTI3G4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
Active filters
Target Symbol
- KLF11